PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G0705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 356aa    MW: 41017.9 Da    PI: 9.9694
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G0705genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.7e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw++yl
      Gh_A04G0705  4 RQRWRAEEDALLCAYVKQYGPREWNLVSHRMNtpLNRDAKSCLERWNNYL 53
                     89***********************************************7 PP

2Myb_DNA-binding36.41.2e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
      Gh_A04G0705  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.412153IPR017930Myb domain
SMARTSM007172.0E-13355IPR001005SANT/Myb domain
SuperFamilySSF466892.68E-21498IPR009057Homeodomain-like
PfamPF002493.7E-13453IPR001005SANT/Myb domain
CDDcd001671.99E-8653No hitNo description
Gene3DG3DSA:1.10.10.609.5E-21660IPR009057Homeodomain-like
PROSITE profilePS5129423.33854108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
PfamPF002493.5E-1059100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-1561102IPR009057Homeodomain-like
CDDcd001672.79E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MKERQRWRAE EDALLCAYVK QYGPREWNLV SHRMNTPLNR DAKSCLERWN NYLKPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE HKEKHKTVEP  120
VEEGKYDRIL ETFAEKIVKQ GHSSAFPMAA SNGGFLHTDP PSPAPPTLLP PWLSNSSNAS  180
VVTPPSPSVT LSLSPSTVAA APPIPWLQPE RMSETSPVLG NMLPHGSFPR SENLLISELM  240
DCCRQLEDGR RAWVAHRKEA AWRLRRVELQ LESEKASRKR KKMEEIESKI EALREEQKST  300
LDRIEAEYRE QLEGLRRDAE AKEQKLAEQW AAKHLHLTKF LEQTGCRPRV VEPNGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-16792789MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-16792789C-Myb DNA-Binding Domain
1msf_C6e-16792789C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277281RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.104020.0boll| leaf| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459482.10.0PREDICTED: transcription factor AS1
RefseqXP_012459483.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-163AS1_ARATH; Transcription factor AS1
TrEMBLA0A0B0PHF60.0A0A0B0PHF6_G
TrEMBLA0A0D2V3W90.0A0A0D2V3W9_G
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-135MYB family protein